Thursday, April 16, 2026
No Result
View All Result
NewsWave
  • Home
  • World
  • USA
  • Business
  • Sports
  • More
    • Entertainment
    • Technology
  • Pricing
  • Login
  • Home
  • World
  • USA
  • Business
  • Sports
  • More
    • Entertainment
    • Technology
  • Pricing
  • Login
No Result
View All Result
NewsWave
No Result
View All Result
Home World USA

Family speaks out after teen with disability is mistakenly detained by federal agents

14 August 2025
in USA
Family speaks out after teen with disability is mistakenly detained by federal agents
Share on FacebookShare on Twitter



The mother of a 15-year-old boy with special needs recounted a traumatic encounter when federal agents mistakenly detained her son at gunpoint outside Arleta High School in California. Los Angeles Unified School District Superintendent Alberto Carvalho condemned the incident, emphasizing the need for improved safety measures around schools, as the agents had left bullets at the scene and failed to verify the boy’s identity before handcuffing him.

Want More Context? 🔎

🌊 Diving deeper into this topic...

🪄 Creating a simple explanation...

Loading PerspectiveSplit analysis...

Tags: agentsDetaineddisabilityfamilyfederalmistakenlyspeaksteen
Previous Post

Bunbury Police are looking for 26-year-old, Tashi Dewa, following welfare concerns from his family

Next Post

Children dying of hunger in Darfur’s el-Fasher city

Related Posts

USA

Pregnant woman reported missing found deceased in Houston

16 April 2026
USA

Democrat Analilia Mejia expected to win New Jersey House special election

16 April 2026
USA

Trump administration broadens visa restrictions in Western Hemisphere

16 April 2026
USA

U.S. intelligence notes China considering radar system transfer to Iran

16 April 2026
USA

Woman arrested after being added to FBI most-wanted list for 2020 murder

16 April 2026
USA

FDA to Consider Peptide Accessibility Following RFK Jr.’s Advocacy

16 April 2026
Please login to join discussion
NewsWave

News Summarized. Time Saved. Bite-sized news briefs for busy people. No fluff, just facts.

CATEGORIES

  • Africa
  • Asia Pacific
  • Australia
  • Business
  • Canada
  • Entertainment
  • Europe
  • India
  • Middle East
  • New Zealand
  • Sports
  • Technology
  • Trending
  • UK
  • USA
  • World

LATEST NEWS STORIES

  • Water Polo NZ chair Alex Howieson resigns amid bullying allegations and club concerns
  • 70-year-old graduates despite illness and challenges
  • Celebrations in Lebanon as ceasefire with Israel begins
  • About Us
  • Disclaimer
  • Privacy Policy
  • Cookie Privacy Policy
  • Terms and Conditions
  • Contact Us

Copyright © 2026 News Wave
News Wave is not responsible for the content of external sites.

No Result
View All Result
  • Home
  • World
  • USA
  • Business
  • Sports
  • More
    • Entertainment
    • Technology
  • Pricing
  • Login

Copyright © 2026 News Wave
News Wave is not responsible for the content of external sites.

Welcome Back!

Login to your account below

Forgotten Password?

Retrieve your password

Please enter your username or email address to reset your password.

Log In