Thursday, September 3, 2026
No Result
View All Result
NewsWave
  • Home
  • World
  • USA
  • Business
  • Sports
  • More
    • Entertainment
    • Technology
  • Pricing1
  • Login
  • Home
  • World
  • USA
  • Business
  • Sports
  • More
    • Entertainment
    • Technology
  • Pricing1
  • Login
No Result
View All Result
NewsWave
No Result
View All Result
Home World USA

Family speaks out after teen with disability is mistakenly detained by federal agents

14 August 2025
in USA
Family speaks out after teen with disability is mistakenly detained by federal agents
Share on FacebookShare on Twitter



The mother of a 15-year-old boy with special needs recounted a traumatic encounter when federal agents mistakenly detained her son at gunpoint outside Arleta High School in California. Los Angeles Unified School District Superintendent Alberto Carvalho condemned the incident, emphasizing the need for improved safety measures around schools, as the agents had left bullets at the scene and failed to verify the boy’s identity before handcuffing him.

Want More Context? 🔎

Analyzing article

Creating explanation

Perspective Meter
Beta
◀ Left Center Right ▶
Media Coverage Split
40%
20%
40%
← Left 40% Center 20% Right 40% →
Left Coverage
Right Coverage
AI Summary of Differences
Unlock Full Analysis — Tidal Access
Tags: agentsDetaineddisabilityfamilyfederalmistakenlyspeaksteen
Previous Post

Bunbury Police are looking for 26-year-old, Tashi Dewa, following welfare concerns from his family

Next Post

Children dying of hunger in Darfur’s el-Fasher city

Related Posts

USA

Retatrutide from China enters US illegal peptide supply chain

2 September 2026
Latest News

Chevron to Expand Operations in Venezuela

2 September 2026
USA

USS Abraham Lincoln arrives in Thailand after 9 months at sea

2 September 2026
USA

Tiger Woods pleads in DUI case, license suspended for five years

2 September 2026
Middle East

Iran Claims Wedding Party Hit in U.S.-Iran Conflict Escalation

2 September 2026
USA

Dancing with the Stars season 35 celebrity cast and pro partners

2 September 2026
Please login to join discussion
NewsWave

News Summarized. Time Saved. Bite-sized news briefs for busy people. No fluff, just facts.

CATEGORIES

  • Africa
  • Asia Pacific
  • Australia
  • Business
  • Canada
  • Entertainment
  • Europe
  • India
  • Latest News
  • Middle East
  • New Zealand
  • Sports
  • Technology
  • Trending
  • UK
  • USA
  • World

LATEST NEWS STORIES

  • Red Bull retains Dutch GP driver line-up for Monza amid Hadjar injury
  • Retatrutide from China enters US illegal peptide supply chain
  • Chevron to Expand Operations in Venezuela
  • About Us
  • Disclaimer
  • Privacy Policy1
  • Cookie Privacy Policy
  • Terms and Conditions1
  • Contact Us

Copyright © 2026 News Wave
News Wave is not responsible for the content of external sites.

No Result
View All Result
  • Home
  • World
  • USA
  • Business
  • Sports
  • More
    • Entertainment
    • Technology
  • Pricing1
  • Login

Copyright © 2026 News Wave
News Wave is not responsible for the content of external sites.

Welcome Back!

Login to your account below

Forgotten Password?

Retrieve your password

Please enter your username or email address to reset your password.

Log In