Tuesday, September 29, 2026
No Result
View All Result
NewsWave
  • Home
  • World
  • USA
  • Business
  • Sports
  • More
    • Entertainment
    • Technology
  • Pricing1
  • Login
  • Home
  • World
  • USA
  • Business
  • Sports
  • More
    • Entertainment
    • Technology
  • Pricing1
  • Login
No Result
View All Result
NewsWave
No Result
View All Result
Home World USA

Family sues pharmacy, drug ‘middleman’ after price hike leads to son’s fatal asthma attack

2 June 2025
in USA
Family sues pharmacy, drug ‘middleman’ after price hike leads to son’s fatal asthma attack
Share on FacebookShare on Twitter


Cole Schmidtknecht, a 22-year-old from Wisconsin, died after being unable to refill his asthma inhaler due to a price increase from less than $70 to over $500. His parents attribute his death to a flawed system involving Pharmacy Benefit Managers (PBMs), which control drug pricing and insurance formularies for profit. They are pursuing legal action against Optum Rx and Walgreens, advocating for policy changes to ensure patients receive adequate notice of formulary changes, aiming for broader justice in the healthcare system.

Full Article

Analyzing article

Creating explanation

Perspective Meter
Beta
◀ Left Center Right ▶
Media Coverage Split
40%
20%
40%
← Left 40% Center 20% Right 40% →
Left Coverage
Right Coverage
AI Summary of Differences
Unlock Full Analysis — Tidal Access
Tags: asthmaAttackdrugfamilyfatalhikeleadsmiddlemanpharmacypricesonssues
Previous Post

Why Patrick Mahomes loved seeing the greatest dynasty in college softball come to an end

Next Post

Cash-strapped Beijing drinkers turn to unlicensed homebars

Related Posts

USA

Retatrutide from China enters US illegal peptide supply chain

2 September 2026
Latest News

Chevron to Expand Operations in Venezuela

2 September 2026
USA

USS Abraham Lincoln arrives in Thailand after 9 months at sea

2 September 2026
USA

Tiger Woods pleads in DUI case, license suspended for five years

2 September 2026
Middle East

Iran Claims Wedding Party Hit in U.S.-Iran Conflict Escalation

2 September 2026
USA

Dancing with the Stars season 35 celebrity cast and pro partners

2 September 2026
NewsWave

News Summarized. Time Saved. Bite-sized news briefs for busy people. No fluff, just facts.

CATEGORIES

  • Africa
  • Asia Pacific
  • Australia
  • Business
  • Canada
  • Entertainment
  • Europe
  • India
  • Latest News
  • Middle East
  • New Zealand
  • Sports
  • Technology
  • Trending
  • UK
  • USA
  • World

LATEST NEWS STORIES

  • Red Bull retains Dutch GP driver line-up for Monza amid Hadjar injury
  • Retatrutide from China enters US illegal peptide supply chain
  • Chevron to Expand Operations in Venezuela
  • About Us
  • Disclaimer
  • Privacy Policy1
  • Cookie Privacy Policy
  • Terms and Conditions1
  • Contact Us

Copyright © 2026 News Wave
News Wave is not responsible for the content of external sites.

No Result
View All Result
  • Home
  • World
  • USA
  • Business
  • Sports
  • More
    • Entertainment
    • Technology
  • Pricing1
  • Login

Copyright © 2026 News Wave
News Wave is not responsible for the content of external sites.

Welcome Back!

Login to your account below

Forgotten Password?

Retrieve your password

Please enter your username or email address to reset your password.

Log In